Product Browser

Last updated: 2017/9/17
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DHRSX purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00207063-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human DHRSX protein.
  • Immunogen:
  • DHRSX (NP_660160.1, 1 a.a. ~ 330 a.a) full-length human protein.
  • Sequence:
  • MSPLSAARAALRVYAVGAAVILAQLLRRCRGGFLEPVFPPRPDRVAIVTGGTDGIGYSTAKHLARLGMHVIIAGNNDSKAKQVVSKIKEETLNDKVEFLYCDLASMTSIRQFVQKFKMKKIPLHVLINNAGVMMVPQRKTRDGFEEHFGLNYLGHFLLTNLLLDTLKESGSPGHSARVVTVSSATHYVAELNMDDLQSSACYSPHAAYAQSKLALVLFTYHLQRLLAAEGSHVTANVVDPGVVNTDLYKHVFWATRLAKKLLGWLLFKTPDEGAWTSIYAAVTPELEGVGGRYLYNEKETKSLHVTYNQKLQQQLWSKSCEMTGVLDVTL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • DHRSX MaxPab polyclonal antibody. Western Blot analysis of DHRSX expression in human liver.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DHRSX expression in transfected 293T cell line (H00207063-T01) by DHRSX MaxPab polyclonal antibody.

    Lane 1: DHRSX transfected lysate(36.3 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • DHRSX
  • Gene Alias:
  • CXorf11,DHRS5X,DHRS5Y,DHRSXY,DHRSY,SDR46C1
  • Gene Description:
  • dehydrogenase/reductase (SDR family) X-linked
  • Other Designations:
  • dehydrogenase/reductase (SDR family) X chromosome,short chain dehydrogenase/reductase family 46C, member 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook