HIPK1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human HIPK1 partial ORF ( AAH28408, 330 a.a. - 430 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.52
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — HIPK1
Entrez GeneID
204851GeneBank Accession#
BC028408Protein Accession#
AAH28408Gene Name
HIPK1
Gene Alias
KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2
Gene Description
homeodomain interacting protein kinase 1
Omim ID
608003Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000013763|OTTHUMP00000013764|OTTHUMP00000013767|OTTHUMP00000013768|homeodomain interacting protein kinase 1-like protein|homeodomain-interacting protein kinase 1|nuclear body associated kinase 2b
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com