HIPK1 monoclonal antibody (M01), clone 4C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HIPK1.
Immunogen
HIPK1 (AAH28408, 330 a.a. ~ 430 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HIPK1 on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HIPK1 is approximately 3ng/ml as a capture antibody.ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to HIPK1 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — HIPK1
Entrez GeneID
204851GeneBank Accession#
BC028408Protein Accession#
AAH28408Gene Name
HIPK1
Gene Alias
KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2
Gene Description
homeodomain interacting protein kinase 1
Omim ID
608003Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000013763|OTTHUMP00000013764|OTTHUMP00000013767|OTTHUMP00000013768|homeodomain interacting protein kinase 1-like protein|homeodomain-interacting protein kinase 1|nuclear body associated kinase 2b
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com