HIPK1 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
HIPK1 polyclonal antibody (A01), Lot # NIH82070326QCS1 Western Blot analysis of HIPK1 expression in Hela S3 NE ( Cat # L013V3 ).
Western Blot detection against Immunogen (37.11 KDa) .
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant HIPK1.
Immunogen
HIPK1 (AAH28408, 330 a.a. ~ 430 a.a) partial recombinant protein with GST tag.
Sequence
CTPLMVATLHPQVATITPQYAVPFTLSCAAGRPALVEQTAAVLQAWPGGTQQILLPSTWQQLPGVALHNSVQPTAMIPEAMGSGQQLADWRNAHSHGNQYS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.11 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
HIPK1 polyclonal antibody (A01), Lot # NIH82070326QCS1 Western Blot analysis of HIPK1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
ELISA
-
Gene Info — HIPK1
Entrez GeneID
204851GeneBank Accession#
BC028408Protein Accession#
AAH28408Gene Name
HIPK1
Gene Alias
KIAA0630, MGC26642, MGC33446, MGC33548, Myak, Nbak2
Gene Description
homeodomain interacting protein kinase 1
Omim ID
608003Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene belongs to the Ser/Thr family of protein kinases and HIPK subfamily. It phosphorylates homeodomain transcription factors and may also function as a co-repressor for homeodomain transcription factors. Alternative splicing results in four transcript variants encoding four distinct isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000013763|OTTHUMP00000013764|OTTHUMP00000013767|OTTHUMP00000013768|homeodomain interacting protein kinase 1-like protein|homeodomain-interacting protein kinase 1|nuclear body associated kinase 2b
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com