Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

RDM1 (Human) Recombinant Protein (P01)

  • Catalog # : H00201299-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human RDM1 full-length ORF ( ABW03899.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MHLLVPPPQHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYCFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 55.11
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • RDM1
  • Gene Alias:
  • MGC33977,RAD52B
  • Gene Description:
  • RAD52 motif 1
  • Gene Summary:
  • This gene encodes a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. The protein encoded by this gene contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization. Alternatively spliced transcript variants encoding different isoforms have been reported. [provided by RefSeq
  • Other Designations:
  • 2410008M22Rik,OTTHUMP00000163946,RAD52 homolog B,RDM1 isoform DeltaN-RDM1alpha,RDM1 isoform DeltaN-RDM1beta,RDM1 isoform DeltaN-RDM1epsilon,RDM1 isoform DeltaN-RDM1gamma,RDM1 isoform DeltaN-RDM1zeta,RDM1 isoform beta,RDM1 isoform delta,RDM1 isoform epsilo
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook