RDM1 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human RDM1 full-length ORF ( ABW03899.1, 1 a.a. - 261 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MHLLVPPPQHSLFTAFSQFGLLYSVRVFPNAAVAHPGFYAVIKFYSARAAHRAQKACDRKQLFQKSPVKVRLGTRHKAVQHQALALNSSKCQELANYCFGFNGCSKRIIKLQELSDLEERENEDSMVPLPKQSLKFFCALEVVLPSCDCRSPGIGLVEEPMDKVEEGPLSFLMKRKTAQKLAIQKALSDAFQKLLIVVLESGKIAVEYRPSEDIVGVRCEEELHGLIQVPCSPWKQYGQEEEGYLSDFSLEEEEFRLPELD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
55.11
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — RDM1
Entrez GeneID
201299GeneBank Accession#
EU176448.1Protein Accession#
ABW03899.1Gene Name
RDM1
Gene Alias
MGC33977, RAD52B
Gene Description
RAD52 motif 1
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein involved in the cellular response to cisplatin, a drug commonly used in chemotherapy. The protein encoded by this gene contains two motifs: a motif found in RAD52, a protein that functions in DNA double-strand breaks and homologous recombination, and an RNA recognition motif (RRM) that is not found in RAD52. The RAD52 motif region in RAD52 is important for protein function and may be involved in DNA binding or oligomerization. Alternatively spliced transcript variants encoding different isoforms have been reported. [provided by RefSeq
Other Designations
2410008M22Rik|OTTHUMP00000163946|RAD52 homolog B|RDM1 isoform DeltaN-RDM1alpha|RDM1 isoform DeltaN-RDM1beta|RDM1 isoform DeltaN-RDM1epsilon|RDM1 isoform DeltaN-RDM1gamma|RDM1 isoform DeltaN-RDM1zeta|RDM1 isoform beta|RDM1 isoform delta|RDM1 isoform epsilo
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com