Product Browser

Last updated: 2017/7/23
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PIP5K3 polyclonal antibody (A01)

  • Catalog # : H00200576-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant PIP5K3.
  • Immunogen:
  • PIP5K3 (NP_689884, 342 a.a. ~ 451 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LQSTEFSETPSPDSDSVNSVEGHSEPSWFKDIKFDDSDTEQIAEEGDDNLANSASPSKRTSVSSFQSTVDSDSAASISLNVELDNVNFHIKKPSKYPHVPPHPADQKGRR
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00200576-A01
    Western Blot detection against Immunogen (38.21 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • PIP5K3 polyclonal antibody (A01), Lot # ABNOVA060628QCS1. Western Blot analysis of PIP5K3 expression in human Skeletal muscle.
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • PIP5K3
  • Gene Alias:
  • CFD,FAB1,KIAA0981,MGC40423,PIKFYVE,PIP5K
  • Gene Description:
  • phosphatidylinositol-3-phosphate/phosphatidylinositol 5-kinase, type III
  • Gene Summary:
  • PIP5K3 belongs to a large family of lipid kinases that alter the phosphorylation status of intracellular phosphatidylinositol. Signaling by phosphorylated species of phosphatidylinositol regulates diverse cellular processes, including membrane trafficking and cytoskeletal reorganization (Shisheva et al., 1999 [PubMed 9858586]).[supplied by OMIM
  • Other Designations:
  • 1-phosphatidylinositol-4-phosphate 5-kinase,FYVE finger-containing phosphoinositide kinase,OTTHUMP00000163872,PtdIns(4)P-5-kinase,phosphatidylinositol-3-phosphate 5-kinase type III,phosphatidylinositol-4-phosphate 5-kinase, type III
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook