APOBEC3F (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human APOBEC3F full-length ORF ( NP_001006667.1, 1 a.a. - 101 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MKPHFRNTVERMYRDTFSYNFYNRPILSRRNTVWLCYEVKTKGPSRPRLDAKIFRGQVPRSFIRAPFQVLSSPFGQCAPPHGTAQVQWPPQLTAGREQGRP
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.2
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — APOBEC3F
Entrez GeneID
200316GeneBank Accession#
NM_001006666.1Protein Accession#
NP_001006667.1Gene Name
APOBEC3F
Gene Alias
ARP8, BK150C2.4.MRNA, KA6, MGC74891
Gene Description
apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F
Omim ID
608993Gene Ontology
HyperlinkGene Summary
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
induced upon T-cell activation
-
Interactome
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com