APOBEC3F polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant APOBEC3F.
Immunogen
APOBEC3F (NP_660341, 274 a.a. ~ 372 a.a) partial recombinant protein with GST tag.
Sequence
YTSWSPCPECAGEVAEFLARHSNVNLTIFTARLYYFWDTDYQEGLRSLSQEGASVEIMGYKDFKYCWENFVYNDDEPFKPWKGLKYNFLFLDSKLQEIL
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
ELISA
-
Gene Info — APOBEC3F
Entrez GeneID
200316GeneBank Accession#
NM_145298Protein Accession#
NP_660341Gene Name
APOBEC3F
Gene Alias
ARP8, BK150C2.4.MRNA, KA6, MGC74891
Gene Description
apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3F
Omim ID
608993Gene Ontology
HyperlinkGene Summary
This gene is a member of the cytidine deaminase gene family. It is one of seven related genes or pseudogenes found in a cluster, thought to result from gene duplication, on chromosome 22. Members of the cluster encode proteins that are structurally and functionally related to the C to U RNA-editing cytidine deaminase APOBEC1. It is thought that the proteins may be RNA editing enzymes and have roles in growth or cell cycle control. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
Other Designations
induced upon T-cell activation
-
Interactome
-
Pathway
-
Publication Reference
-
Expression and subcellular localisation of AID and APOBEC3 in adenoid and palatine tonsils.
Seishima N, Kondo S, Wakae K, Wakisaka N, Kobayashi E, Kano M, Moriyama-Kita M, Nakanishi Y, Endo K, Imoto T, Ishikawa K, Sugimoto H, Hatano M, Ueno T, Koura M, Kitamura K, Muramatsu M, Yoshizaki T.
Scientific Reports 2018 Jan; 8(1):918.
Application:IHC-P, Human, Adenoids ,palatine tonsils.
-
A novel HIV-1 restriction factor that is biologically distinct from APOBEC3 cytidine deaminases in a human T cell line CEM.NKR.
Zhou T, Han Y, Dang Y, Wang X, Zheng YH.
Retrovirology 2009 Apr; 6:31.
Application:WB, Human, CEM.NKR, H9 cells.
-
APOBEC3G and APOBEC3F Require an Endogenous Cofactor to Block HIV-1 Replication.
Han Y, Wang X, Dang Y, Zheng YH.
PLoS Pathogens 2008 Jul; 4(7):e1000095.
Application:WB-Ce, Human, A3.01, CEM-SS, CEM-T4, H9, HUT 78 cells.
-
Expression and subcellular localisation of AID and APOBEC3 in adenoid and palatine tonsils.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com