UBR1 monoclonal antibody (M01), clone 2F5
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant UBR1.
Immunogen
UBR1 (NP_777576, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
UBR1 monoclonal antibody (M01), clone 2F5 Western Blot analysis of UBR1 expression in Hela S3 NE ( Cat # L013V3 ).Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged UBR1 is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — UBR1
Entrez GeneID
197131GeneBank Accession#
NM_17491Protein Accession#
NP_777576Gene Name
UBR1
Gene Alias
JBS, MGC142065, MGC142067
Gene Description
ubiquitin protein ligase E3 component n-recognin 1
Gene Ontology
HyperlinkGene Summary
The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. [provided by RefSeq
Other Designations
E3a ligase|ubiquitin ligase E3 alpha-I|ubiquitin-protein ligase E3-alpha
-
Interactome
-
Disease
-
Publication Reference
-
Roles of STAT3/SOCS3 pathway in regulation of the visual function and ubiquitin proteasome-dependent degradation of Rhodopsin during retinal inflammation.
Ozawa Y, Nakao K, Kurihara T, Shimazaki T, Shimmura S, Ishida S, Yoshimura A, Tsubota K, Okano H.
The Journal of Biological Chemistry 2008 Jul; 283(36):24561.
Application:IF, IHC-Fr, Mouse, Mouse retina.
-
Roles of STAT3/SOCS3 pathway in regulation of the visual function and ubiquitin proteasome-dependent degradation of Rhodopsin during retinal inflammation.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com