Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

  • By Disease

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

UBR1 polyclonal antibody (A01)

  • Catalog # : H00197131-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant UBR1.
  • Immunogen:
  • UBR1 (NP_777576, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • ADEEAGGTERMEISAELPQTPQRLASWWDQQVDFYTAFLHHLAQLVPEIYFAEMDPDLEKQEESVQMSIFTPLEWYLFGEDPDICLEKLKHSGAFQLCG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00197131-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • UBR1 polyclonal antibody (A01), Lot # 060802QCS1 Western Blot analysis of UBR1 expression in K-562 ( Cat # L009V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • UBR1
  • Gene Alias:
  • JBS,MGC142065,MGC142067
  • Gene Description:
  • ubiquitin protein ligase E3 component n-recognin 1
  • Gene Summary:
  • The N-end rule pathway is one proteolytic pathway of the ubiquitin system. The recognition component of this pathway, encoded by this gene, binds to a destabilizing N-terminal residue of a substrate protein and participates in the formation of a substrate-linked multiubiquitin chain. This leads to the eventual degradation of the substrate protein. The protein described in this record has a RING-type zinc finger and a UBR-type zinc finger. Mutations in this gene have been associated with Johanson-Blizzard syndrome. [provided by RefSeq
  • Other Designations:
  • E3a ligase,ubiquitin ligase E3 alpha-I,ubiquitin-protein ligase E3-alpha
  • Related Disease
  • RSS
  • YouTube
  • Linkedin
  • Facebook