Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IMMP1L (Human) Recombinant Protein (P01)

  • Catalog # : H00196294-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IMMP1L full-length ORF ( NP_659418.1, 1 a.a. - 166 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MLRGVLGKTFRLVGYTIQYGCIAHCAFEYVGGVVMCSGPSMEPTIQNSDIVFAENLSRHFYGIQRGDIVIAKSPSDPKSNICKRVIGLEGDKILTTSPSDFFKSHSYVPMGHVWLEGDNLQNSTDSRCYGPIPYGLIRGRIFFKIWPLSDFGFLRASPNGHRFSDD
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.9
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00196294-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • IMMP1L
  • Gene Alias:
  • FLJ25059,IMP1,IMP1-LIKE
  • Gene Description:
  • IMP1 inner mitochondrial membrane peptidase-like (S. cerevisiae)
  • Gene Summary:
  • The mitochondrial inner membrane peptidase (IMP) complex generates mature, active proteins in the mitochondrial intermembrane space by proteolytically removing the mitochondrial targeting presequence of nuclear-encoded proteins. IMP1 and IMP2 (IMMP2L; MIM 605977) are the catalytic subunits of the IMP complex (Burri et al., 2005 [PubMed 15814844]).[supplied by OMIM
  • Other Designations:
  • IMP1 inner mitochondrial membrane peptidase-like
  • RSS
  • YouTube
  • Linkedin
  • Facebook