ASXL1 monoclonal antibody (M05), clone 6E2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
ASXL1 monoclonal antibody (M05), clone 6E2. Western Blot analysis of ASXL1 expression in K-562.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (35.9 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant ASXL1.
Immunogen
ASXL1 (AAH64984.1, 1 a.a. ~ 84 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (35.9 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
ASXL1 monoclonal antibody (M05), clone 6E2. Western Blot analysis of ASXL1 expression in K-562.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ASXL1 is 0.3 ng/ml as a capture antibody.ELISA
-
Gene Info — ASXL1
Entrez GeneID
171023GeneBank Accession#
BC064984.1Protein Accession#
AAH64984.1Gene Name
ASXL1
Gene Alias
KIAA0978, MGC117280, MGC71111
Gene Description
additional sex combs like 1 (Drosophila)
Gene Ontology
HyperlinkGene Summary
This gene is similar to the Drosophila additional sex combs gene, which encodes a chromatin-binding protein required for normal determination of segment identity in the developing embryo. The protein is a member of the Polycomb group of proteins, which are necessary for the maintenance of stable repression of homeotic and other loci. The protein is thought to disrupt chromatin in localized areas, enhancing transcription of certain genes while repressing the transcription of other genes. The protein encoded by this gene functions as a ligand-dependent co-activator for retinoic acid receptor in cooperation with nuclear receptor coactivator 1. Mutations in this gene are associated with myelodysplastic syndromes and chronic myelomonocytic leukemia. Alternative splicing results in multiple transcript variants. [provided by RefSeq
Other Designations
OTTHUMP00000030592|additional sex combs like 1
-
Interactome
-
Disease
-
Publication Reference
-
Silencing of ASXL1 impairs the granulomonocytic lineage potential of human CD34(+) progenitor cells.
Davies C, Yip BH, Fernandez-Mercado M, Woll PS, Agirre X, Prosper F, Jacobsen SE, Wainscoat JS, Pellagatti A, Boultwood J.
British Journal of Haematology 2013 Jan; 160(6):842.
Application：WB, Human, NB-4, K-562 cells.
-
Silencing of ASXL1 impairs the granulomonocytic lineage potential of human CD34(+) progenitor cells.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com