KCNG3 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human KCNG3 partial ORF ( NP_579875, 23 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — KCNG3
Entrez GeneID
170850GeneBank Accession#
NM_133329Protein Accession#
NP_579875Gene Name
KCNG3
Gene Alias
KV10.1, KV6.3
Gene Description
potassium voltage-gated channel, subfamily G, member 3
Omim ID
606767Gene Ontology
HyperlinkGene Summary
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member is a gamma subunit functioning as a modulatory molecule. Alternative splicing results in two transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000158764|voltage-gated potassium channel 6.3|voltage-gated potassium channel Kv10.1|voltage-gated potassium channel subunit Kv6.4
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com