KCNG3 polyclonal antibody (A01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a partial recombinant KCNG3.
Immunogen
KCNG3 (NP_579875, 23 a.a. ~ 121 a.a) partial recombinant protein with GST tag.
Sequence
SRELLKDFPLRRVSRLHGCRSERDVLEVCDDYDRERNEYFFDRHSEAFGFILLYVRGHGKLRFAPRMCELSFYNEMIYWGLEGAHLEYCCQRRLDDRMS
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37 KDa) .
Storage Buffer
50 % glycerol
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
KCNG3 polyclonal antibody (A01). Western Blot analysis of KCNG3 expression in human ovarian cancer.Western Blot (Recombinant protein)
ELISA
-
Gene Info — KCNG3
Entrez GeneID
170850GeneBank Accession#
NM_133329Protein Accession#
NP_579875Gene Name
KCNG3
Gene Alias
KV10.1, KV6.3
Gene Description
potassium voltage-gated channel, subfamily G, member 3
Omim ID
606767Gene Ontology
HyperlinkGene Summary
Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, subfamily G. This member is a gamma subunit functioning as a modulatory molecule. Alternative splicing results in two transcript variants encoding distinct isoforms. [provided by RefSeq
Other Designations
OTTHUMP00000158764|voltage-gated potassium channel 6.3|voltage-gated potassium channel Kv10.1|voltage-gated potassium channel subunit Kv6.4
-
Publication Reference
-
De novo expression of Kv6.3 contributes to changes in vascular smooth muscle cell excitability in a hypertensive mice strain.
Moreno-Dominguez A, Cidad P, Miguel-Velado E, Lopez-Lopez JR, Perez-Garcia MT.
The Journal of Physiology 2009 Feb; 587(3):625.
Application:WB-Ce, Mouse, Mouse vascular smooth muscle cells.
-
De novo expression of Kv6.3 contributes to changes in vascular smooth muscle cell excitability in a hypertensive mice strain.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com