ADAMTS17 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human ADAMTS17 partial ORF ( NP_620688, 543 a.a. - 650 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
DGDWSPWGAWSMCSRTCGTGARFRQRKCDNPPPGPGGTHCPGASVEHAVCENLPCPKGLPSFRDQQCQAHDRLSPKKKGLLTAVVVDDKPCELYCSPLGKESPLLVAD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
37.62
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — ADAMTS17
Entrez GeneID
170691GeneBank Accession#
NM_139057Protein Accession#
NP_620688Gene Name
ADAMTS17
Gene Alias
FLJ16363, FLJ32769
Gene Description
ADAM metallopeptidase with thrombospondin type 1 motif, 17
Omim ID
607511Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the ADAMTS (a disintegrin and metalloproteinase with thrombospondin motifs) protein family. ADAMTS family members share several distinct protein modules, including a propeptide region, a metalloproteinase domain, a disintegrin-like domain, and a thrombospondin type 1 (TS) motif. Individual members of this family differ in the number of C-terminal TS motifs, and some have unique C-terminal domains. The protein encoded by this gene has a high sequence similarity to the protein encoded by ADAMTS19, another family member. The function of this protein has not been determined. [provided by RefSeq
Other Designations
a disintegrin-like and metalloprotease (reprolysin type) with thrombospondin type 1 motif, 17
-
Interactome
-
Disease
-
Publication Reference
-
Homozygous mutations in ADAMTS10 and ADAMTS17 cause lenticular myopia, ectopia lentis, glaucoma, spherophakia, and short stature.
Jose Morales, Latifa Al-Sharif, Dania S Khalil, Jameela M A Shinwari, Prashant Bavi, Rahima A Al-Mahrouqi, Ali Al-Rajhi, Fowzan S Alkuraya, Brian F Meyer, Nada Al Tassan.
American Journal of Human Genetics 2009 Nov; 85(5):558.
Application：IHC-P, Human, MCF-7 cells.
-
Homozygous mutations in ADAMTS10 and ADAMTS17 cause lenticular myopia, ectopia lentis, glaucoma, spherophakia, and short stature.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com