Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IDO2 (Human) Recombinant Protein (P01)

  • Catalog # : H00169355-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human IDO2 full-length ORF ( ADR83478.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGDGVSLCLPGWSAVA
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 19
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • IDO2
  • Gene Alias:
  • INDOL1
  • Gene Description:
  • indoleamine 2,3-dioxygenase 2
  • Gene Summary:
  • Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway (Ball et al., 2007 [PubMed 17499941]).[supplied by OMIM
  • Other Designations:
  • indoleamine 2,3-dioxygenase-like 1 protein,indoleamine-pyrrole 2,3 dioxygenase-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook