Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IDO2 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00169355-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human IDO2 protein.
  • Immunogen:
  • IDO2 (ADR83478.1, 1 a.a. ~ 172 a.a) full-length human protein.
  • Sequence:
  • MLHFHYYDTSNKIMEPHRPNVKTAVPLSLESYHISEEYGFLLPDSLKELPDHYRPWMEIANKLPQLIDAHQLQAHVDKMPLLSCQFLKGHREQRLAHLVLSFLTMGYVWQEGEAQPAEVLPRNLALPFVEVSRNLGLPPILVHSDLVLTNWTKKDPDGDGVSLCLPGWSAVA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Application Image
  • Western Blot (Transfected lysate)
  • Gene Information
  • Gene Name:
  • IDO2
  • Gene Alias:
  • INDOL1
  • Gene Description:
  • indoleamine 2,3-dioxygenase 2
  • Gene Summary:
  • Along with the enzymes encoded by the INDO (MIM 147435) and TDO2 (MIM 191070) genes, the enzyme encoded by the INDOL1 gene metabolizes tryptophan in the kynurenine pathway (Ball et al., 2007 [PubMed 17499941]).[supplied by OMIM
  • Other Designations:
  • indoleamine 2,3-dioxygenase-like 1 protein,indoleamine-pyrrole 2,3 dioxygenase-like 1
  • RSS
  • YouTube
  • Linkedin
  • Facebook