ZNF92 monoclonal antibody (M01), clone 1F2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of ZNF92 expression in transfected 293T cell line by ZNF92 monoclonal antibody (M01), clone 1F2.
Lane 1: ZNF92 transfected lysate(60.2 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ZNF92 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.2 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF92 is approximately 0.1ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.41 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant ZNF92.
Immunogen
ZNF92 (NP_689839, 490 a.a. ~ 586 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
FNQSSIFTKHKIIHTEGKSYKCEKCGNAFNQSSNLTARKIIYTGEKPYKYEECDKAFNKFSTLITHQIIYTGEKPCKHECGRAFNKSSNYTKEKLQT
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.41 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of ZNF92 expression in transfected 293T cell line by ZNF92 monoclonal antibody (M01), clone 1F2.
Lane 1: ZNF92 transfected lysate(60.2 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to ZNF92 on formalin-fixed paraffin-embedded human prostate. [antibody concentration 1.2 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged ZNF92 is approximately 0.1ng/ml as a capture antibody.ELISA
-
Gene Info — ZNF92
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com