Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MGC26963 polyclonal antibody (A01)

  • Catalog # : H00166929-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MGC26963.
  • Immunogen:
  • MGC26963 (NP_689834, 2 a.a. ~ 80 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • DIIETAKLEEHLENQPSDPTNTYARPAEPVEEENKNGNGKPKSLSSGLRKGTKKYPDYIQIAMPTESRNKFPLEWWKTG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00166929-A01
    Western Blot detection against Immunogen (34.8 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • SGMS2
  • Gene Alias:
  • MGC26963,SMS2
  • Gene Description:
  • sphingomyelin synthase 2
  • Gene Summary:
  • Sphingomyelin, a major component of cell and Golgi membranes, is made by the transfer of phosphocholine from phosphatidylcholine onto ceramide, with diacylglycerol as a side product. The protein encoded by this gene is an enzyme that catalyzes this reaction primarily at the cell membrane. The synthesis is reversible, and this enzyme can catalyze the reaction in either direction. The encoded protein is required for cell growth. Three transcript variants encoding the same protein have been found for this gene. There is evidence for more variants, but the full-length nature of their transcripts has not been determined
  • Other Designations:
  • OTTHUMP00000162627,OTTHUMP00000162628,SM synthase,phosphatidylcholine:ceramide cholinephosphotransferase 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook