Product Browser

Last updated: 2017/11/19
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DCAMKL2 monoclonal antibody (M01), clone 2A5

  • Catalog # : H00166614-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant DCAMKL2.
  • Immunogen:
  • DCAMKL2 (AAH32726, 348 a.a. ~ 438 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • FRGLKISAHGRSSSNVNGGPELDRCISPEGVNGNRCSESSTLLEKYKIGKVIGDGNFAVVKECIDRSTGKEFALKIIDKAKCCGKEHLIE*
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00166614-M01
    Western Blot detection against Immunogen (36.01 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • DCLK2
  • Gene Alias:
  • DCAMKL2,DCDC3,DCDC3B,DCK2,DKFZp761I032,MGC45428
  • Gene Description:
  • doublecortin-like kinase 2
  • Other Designations:
  • doublecortin and CaM kinase-like 2
  • RSS
  • YouTube
  • Linkedin
  • Facebook