Product Browser

Last updated: 2017/6/25
  • Related Product Showcase
  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

APOBEC3H purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00164668-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human APOBEC3H protein.
  • Immunogen:
  • APOBEC3H (AAH69023.1, 1 a.a. ~ 182 a.a) full-length human protein.
  • Sequence:
  • MALLTAETFRLQFNNKRRLRRPYYPRKALLCYQLTPQNGSTPTRGYFENKKKCHAEICFINEIKSMGLDETQCYQVTCYLTWSPCSSCAWELVDFIKAHDHLNLGIFASRLYYHWCKPQQKGLRLLCGSQVPVEVMGFPEFADCWENFVDHEKPLSFNPYKMLEELDKNSRAIKRRLERIKS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • RP4-742C19.3 MaxPab polyclonal antibody. Western Blot analysis of RP4-742C19.3 expression in human colon.
  • PDF DownloadProtocol Download
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of APOBEC3H expression in transfected 293T cell line (H00164668-T02) by APOBEC3H MaxPab polyclonal antibody.

    Lane 1: RP4-742C19.3 transfected lysate(20.02 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Tissue lysate)
  • Western Blot (Tissue lysate)
  • enlarge
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • APOBEC3H
  • Gene Alias:
  • ARP10,dJ742C19.2
  • Gene Description:
  • apolipoprotein B mRNA editing enzyme, catalytic polypeptide-like 3H
  • Gene Summary:
  • Members of the APOBEC family of proteins, like APOBEC3H, are mRNA editing enzymes that affect protein diversity by deamination of cytidine to produce uridine (Wedekind et al., 2003 [PubMed 12683974]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000028980
  • RSS
  • YouTube
  • Linkedin
  • Facebook