CLEC12A (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CLEC12A partial ORF (ADR82900.1, 108 a.a. - 221 a.a.) recombinant protein with GST tag at N-terminal.
Sequence
TTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRNAPD
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
38.17
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CLEC12A
Entrez GeneID
160364GeneBank Accession#
HQ258146.1Protein Accession#
ADR82900.1Gene Name
CLEC12A
Gene Alias
CLL-1, CLL1, DCAL-2, MGC70602, MICL
Gene Description
C-type lectin domain family 12, member A
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The protein encoded by this gene is a negative regulator of granulocyte and monocyte function. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. This gene is closely linked to other CTL/CTLD superfamily members in the natural killer gene complex region on chromosome 12p13. [provided by RefSeq
Other Designations
C-type lectin protein CLL-1|C-type lectin superfamily|C-type lectin-like molecule-1|dendritic cell associated lectin 2|myeloid inhibitory C-type lectin-like receptor
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com