Product Browser

Last updated: 2017/5/28

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLEC12A (Human) Recombinant Protein (Q01)

  • Catalog # : H00160364-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CLEC12A partial ORF (ADR82900.1, 108 a.a. - 221 a.a.) recombinant protein with GST tag at N-terminal.
  • Sequence:
  • TTLQTIATKLCRELYSKEQEHKCKPCPRRWIWHKDSCYFLSDDVQTWQESKMACAAQNASLLKINNKNALEFIKSQSRSYDYWLGLSPEEDSTRGMRVDNIINSSAWVIRNAPD
  • Theoretical MW (kDa):
  • 38.17
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue

    QC Testing of H00160364-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CLEC12A
  • Gene Alias:
  • CLL-1,CLL1,DCAL-2,MGC70602,MICL
  • Gene Description:
  • C-type lectin domain family 12, member A
  • Gene Summary:
  • This gene encodes a member of the C-type lectin/C-type lectin-like domain (CTL/CTLD) superfamily. Members of this family share a common protein fold and have diverse functions, such as cell adhesion, cell-cell signalling, glycoprotein turnover, and roles in inflammation and immune response. The protein encoded by this gene is a negative regulator of granulocyte and monocyte function. Several alternatively spliced transcript variants of this gene have been described, but the full-length nature of some of these variants has not been determined. This gene is closely linked to other CTL/CTLD superfamily members in the natural killer gene complex region on chromosome 12p13. [provided by RefSeq
  • Other Designations:
  • C-type lectin protein CLL-1,C-type lectin superfamily,C-type lectin-like molecule-1,dendritic cell associated lectin 2,myeloid inhibitory C-type lectin-like receptor
  • RSS
  • YouTube
  • Linkedin
  • Facebook