NKX2-3 (Human) Recombinant Protein (P01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human NKX2-3 full-length ORF ( NP_660328.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAGPPRRPLPCSPPAARPEAAPL
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
58.9
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — NKX2-3
Entrez GeneID
159296GeneBank Accession#
NM_145285.1Protein Accession#
NP_660328.1Gene Name
NKX2-3
Gene Alias
CSX3, NK2.3, NKX2.3, NKX2C, NKX4-3
Gene Description
NK2 transcription factor related, locus 3 (Drosophila)
Omim ID
606727Gene Ontology
HyperlinkGene Summary
NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM
Other Designations
NK-2 homolog C|NK2 transcription factor homolog C|NK2 transcription factor related, locus 3|OTTHUMP00000020258|homeobox protein NKX2-3 homolog, mouse
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com