Product Browser

Last updated: 2017/10/15

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NKX2-3 (Human) Recombinant Protein (P01)

  • Catalog # : H00159296-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human NKX2-3 full-length ORF ( NP_660328.1, 1 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MMLPSPVTSTPFSVKDILNLEQQHQHFHGAHLQADLEHHFHSAPCMLAAAEGTQFSDGGEEDEEDEGEKLSYLNSLAAADGHGDSGLCPQGYVHTVLRDSCSEPKEHEEEPEVVRDRSQKSCQLKKSLETAGDCKAAEESERPKPRSRRKPRVLFSQAQVFELERRFKQQRYLSAPEREHLASSLKLTSTQVKIWFQNRRYKCKRQRQDKSLELGAHAPPPPPRRVAVPVLVRDGKPCVTPSAQAYGAPYSVGASAYSYNSFPAYGYGNSAAGPPRRPLPCSPPAARPEAAPL
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 58.9
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00159296-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • NKX2-3
  • Gene Alias:
  • CSX3,NK2.3,NKX2.3,NKX2C,NKX4-3
  • Gene Description:
  • NK2 transcription factor related, locus 3 (Drosophila)
  • Gene Summary:
  • NKX2C is a member of the NKX family of homeodomain-containing transcription factors, which are implicated in many aspects of cell type specification and maintenance of differentiated tissue functions. See Harvey (1996) [PubMed 8812123] for a review of the structure, regulation, function, and evolution of NK2 homeobox genes with an emphasis on their roles in heart development.[supplied by OMIM
  • Other Designations:
  • NK-2 homolog C,NK2 transcription factor homolog C,NK2 transcription factor related, locus 3,OTTHUMP00000020258,homeobox protein NKX2-3 homolog, mouse
  • RSS
  • YouTube
  • Linkedin
  • Facebook