Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C9orf98 monoclonal antibody (M01), clone 3B8

  • Catalog # : H00158067-M01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse monoclonal antibody raised against a partial recombinant C9orf98.
  • Immunogen:
  • C9orf98 (NP_689785, 381 a.a. ~ 479 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
  • Sequence:
  • PFDSIMERLTLRRIDPVTGERYHLMYKPPPTMEIQARLLQNPKDAEEQVKLKMDLFYRNSADLEQLYGSAITLNGDQDPYTVFEYIESGIINPLPKKIP
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Isotype:
  • IgG1 Kappa
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00158067-M01
    Western Blot detection against Immunogen (36.63 KDa) .
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of C9orf98 expression in transfected 293T cell line by C9orf98 monoclonal antibody (M01), clone 3B8.

    Lane 1: C9orf98 transfected lysate(54.9 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • Western blot analysis of C9orf98 over-expressed 293 cell line, cotransfected with C9orf98 Validated Chimera RNAi ( Cat # H00158067-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with C9orf98 monoclonal antibody (M01), clone 3B8 (Cat # H00158067-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • RNAi Knockdown (Antibody validated)
  • RNAi Knockdown (Antibody validated)
  • enlarge
  • Gene Information
  • Gene Name:
  • C9orf98
  • Gene Alias:
  • DDX31,FLJ32704,FLJ36014,RP11-143F18.1
  • Gene Description:
  • chromosome 9 open reading frame 98
  • Other Designations:
  • OTTHUMP00000022737,putative adenylate kinase-like protein C9orf98
  • RSS
  • YouTube
  • Linkedin
  • Facebook