Product Browser

Last updated: 2017/11/12
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

IBRDC1 polyclonal antibody (A01)

  • Catalog # : H00154214-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant IBRDC1.
  • Immunogen:
  • IBRDC1 (NP_689766, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • KVQLGQVEIKCPITECFEFLEETTVVYNLTHEDSIKYKYFLELGRIDSSTKPCPQCKHFTTFKKKGHIPTPSRSESKYKIQCPTCQFVWCFKCHSPWHE
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00154214-A01
    Western Blot detection against Immunogen (37 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • RNF217
  • Gene Alias:
  • C6orf172,IBRDC1,MGC26996,dJ84N20.1
  • Gene Description:
  • ring finger protein 217
  • Other Designations:
  • IBR domain containing 1,OTTHUMP00000017130,OTTHUMP00000017132
  • RSS
  • YouTube
  • Linkedin
  • Facebook