CNKSR3 monoclonal antibody (M01), clone 4A11
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CNKSR3 expression in transfected 293T cell line by CNKSR3 monoclonal antibody (M01), clone 4A11.
Lane 1: CNKSR3 transfected lysate (Predicted MW: 61.9 KDa).
Lane 2: Non-transfected lysate.
Immunoprecipitation
Immunoprecipitation of CNKSR3 transfected lysate using anti-CNKSR3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CNKSR3 MaxPab rabbit polyclonal antibody.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CNKSR3 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (36.63 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CNKSR3.
Immunogen
CNKSR3 (NP_775786, 366 a.a. ~ 464 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGSSKCKQPLPGPKGSESPNSFLDQESRRRRFTIADSDQLPGYSVETNILPTKMREKTPSYGKPRPLSMPADGNWMGIVDPFARPRGHGRKGEDALCRY
Host
Mouse
Reactivity
Human
Isotype
IgG2b Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.63 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CNKSR3 expression in transfected 293T cell line by CNKSR3 monoclonal antibody (M01), clone 4A11.
Lane 1: CNKSR3 transfected lysate (Predicted MW: 61.9 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Immunoprecipitation
Immunoprecipitation of CNKSR3 transfected lysate using anti-CNKSR3 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with CNKSR3 MaxPab rabbit polyclonal antibody.Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CNKSR3 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — CNKSR3
Entrez GeneID
154043GeneBank Accession#
NM_173515Protein Accession#
NP_775786Gene Name
CNKSR3
Gene Alias
FLJ31349, MAGI1
Gene Description
CNKSR family member 3
Gene Ontology
HyperlinkGene Summary
WW and PDZ domain containing 1
Other Designations
OTTHUMP00000017466|membrane associated guanylate kinase interacting protein-like 1|membrane associated guanylate kinase, WW and PDZ domain containing 1
-
Interactome
-
Disease
-
Publication Reference
-
CNK2 promotes cancer cell motility by mediating ARF6 activation downstream of AXL signalling
Guillaume Serwe, David Kachaner, Jessica Gagnon, Cédric Plutoni , Driss Lajoie, Eloïse Duramé, Malha Sahmi, Damien Garrido, Martin Lefrançois, Geneviève Arseneault, Marc K Saba-El-Leil, Sylvain Meloche, Gregory Emery, Marc Therrien.
Nature Communications 2023 Jun; 14(1):3560.
Application：WB-Ce, Human, A375, A549, HOS, LN-229, MDA-MB-231, U2OS cells.
-
CNK2 promotes cancer cell motility by mediating ARF6 activation downstream of AXL signalling
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com