SH3D19 monoclonal antibody (M01), clone 5C7
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
SH3D19 monoclonal antibody (M01), clone 5C7 Western Blot analysis of SH3D19 expression in HeLa ( Cat # L013V1 ).
Western Blot (Cell lysate)
SH3D19 monoclonal antibody (M01), clone 5C7. Western Blot analysis of SH3D19 expression in Raw 264.7(Cat # L024V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SH3D19 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]
Immunofluorescence
Immunofluorescence of monoclonal antibody to SH3D19 on HeLa cell. [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant SH3D19.
Immunogen
SH3D19 (NP_001009555, 94 a.a. ~ 203 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PVTKPELPKKPNPGLIRSVNPEIPGRGPLAESSDSGKKVPTPAPRPLLLKKSVSSENPTYPSAPLKPVTVPPRLAGASQAKAYKSLGEGPPANPPVPVLQSKPLVDIDLI
Host
Mouse
Reactivity
Human, Mouse
Isotype
IgG3 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
SH3D19 monoclonal antibody (M01), clone 5C7 Western Blot analysis of SH3D19 expression in HeLa ( Cat # L013V1 ).Western Blot (Cell lysate)
SH3D19 monoclonal antibody (M01), clone 5C7. Western Blot analysis of SH3D19 expression in Raw 264.7(Cat # L024V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to SH3D19 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]ELISA
Immunofluorescence
Immunofluorescence of monoclonal antibody to SH3D19 on HeLa cell. [antibody concentration 10 ug/ml] -
Gene Info — SH3D19
Entrez GeneID
152503GeneBank Accession#
NM_001009555Protein Accession#
NP_001009555Gene Name
SH3D19
Gene Alias
EBP, EVE1, Kryn, MGC105136, MGC118910, MGC118911, MGC118912, MGC118913, SH3P19
Gene Description
SH3 domain containing 19
Omim ID
608674Gene Ontology
HyperlinkOther Designations
EEN binding protein|SH3 domain protein D19
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com