Product Browser

Last updated: 2020/7/12

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CMTM8 DNAxPab DNAxPab

  • Catalog # : H00152189-W01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human CMTM8 DNA using DNAx™ Immune technology.
  • Immunogen:
  • Full-length human DNA
  • Sequence:
  • MEEPQRARSHTVTTTASSFAENFSTSSSSFAYDREFLRTLPGFLIVAEIVLGLLVWTLIAGTEYFRVPAFGWVMFVAVFYWVLTVFFLIIYITMTYTRIPQVPWTTVGLCFNGSAFVLYLSAAVVDASSVSPERDSHNFNSWAASSFFAFLVTICYAGNTYFSFIAWRSRTIQ
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Purification:
  • Protein A
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Immunofluorescence (Transfected cell)
  • Immunofluorescence (Exosome)
  • Flow Cytometry (Transfected cell)
  • Application Image
  • Western Blot (Transfected lysate)
  • Immunofluorescence (Transfected cell)
  • Immunofluorescence (Exosome)
  • Flow Cytometry (Transfected cell)
  • Gene Information
  • Gene Name:
  • CMTM8
  • Gene Alias:
  • CKLFSF8,CKLFSF8-V2
  • Gene Description:
  • CKLF-like MARVEL transmembrane domain containing 8
  • Gene Summary:
  • This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene is widely expressed in many tissues, but the exact function of the encoded protein is unknown. [provided by RefSeq
  • Other Designations:
  • chemokine-like factor super family 8,chemokine-like factor superfamily 8
  • RSS
  • YouTube
  • Linkedin
  • Facebook