NSE1 monoclonal antibody (M01), clone 1C2
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Cell lysate)
NSE1 monoclonal antibody (M01), clone 1C2 Western Blot analysis of NSE1 expression in HL-60 ( Cat # L014V1 ).
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FAM84A on formalin-fixed paraffin-embedded human prostate cancer. [antibody concentration 5 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FAM84A is approximately 0.03ng/ml as a capture antibody.
Western Blot detection against Immunogen (57.86 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full length recombinant NSE1.
Immunogen
NSE1 (AAH26346, 1 a.a. ~ 292 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MGNQLDRITHLNYSELPTGDPSGIEKDELRVGVAYFFSDDEEDLDERGQPDKFGVKAPPGCTPCPESPSRHHHHLLHQLVLNETQFSAFRGQECIFSKVSGGPQGADLSVYAVTALPALCEPGDLLELLWLQHAPEPPAPAPHWAVYVGGGQIIHLHQGEIRQDSLYEAGAANVGRVVNSWYRYRPLVAELVVQNACGHLGLKSEEICWTNSESFAAWCRFGKREFKAGGEVPAGTQPPQQQYYLKVHLGENKVHTARFHSLEDLIREKRRIDASGRLRVLQELADLVDDKE
Host
Mouse
Reactivity
Human
Isotype
IgG1 kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (57.86 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
NSE1 monoclonal antibody (M01), clone 1C2 Western Blot analysis of NSE1 expression in HL-60 ( Cat # L014V1 ).Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to FAM84A on formalin-fixed paraffin-embedded human prostate cancer. [antibody concentration 5 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged FAM84A is approximately 0.03ng/ml as a capture antibody.ELISA
-
Gene Info — FAM84A
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com