Product Browser

Last updated: 2017/3/26
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

PPP1R1C purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00151242-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human PPP1R1C protein.
  • Immunogen:
  • PPP1R1C (NP_001074014.1, 1 a.a. ~ 109 a.a) full-length human protein.
  • Sequence:
  • MEPNSPKKIQFAVPVFQSQIAPEAAEQIRKRRPTPASLVILNEHNPPEIDDKRGPNTQGELQNASPKQRKQSVYTPPTIKGVKHLKGQNESAFPEEEEGTNEREEQRDH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of PPP1R1C expression in transfected 293T cell line (H00151242-T01) by PPP1R1C MaxPab polyclonal antibody.

    Lane 1: PPP1R1C transfected lysate(11.99 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • PPP1R1C
  • Gene Alias:
  • IPP5
  • Gene Description:
  • protein phosphatase 1, regulatory (inhibitor) subunit 1C
  • Other Designations:
  • Inhibitor-1-like,PP1 inhibitor protein 5,inhibitor-5 of protein phosphatase 1,protein phosphatase 1 regulatory subunit 1A
  • RSS
  • YouTube
  • Linkedin
  • Facebook