NFAM1 monoclonal antibody (M10), clone 2E9
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of NFAM1 expression in transfected 293T cell line by NFAM1 monoclonal antibody (M10), clone 2E9.
Lane 1: NFAM1 transfected lysate (Predicted MW: 29.7 KDa).
Lane 2: Non-transfected lysate.
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NFAM1 is 10 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.87 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant NFAM1.
Immunogen
NFAM1 (NP_666017.1, 187 a.a. ~ 269 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
NKKRMRGPGKDPTRKCPDPRSASSPKQHPSESVYTALQRRETEVYACIENEDGSSPTAKQSPLSQERPHRFEDDGELNLVYEN
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.87 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of NFAM1 expression in transfected 293T cell line by NFAM1 monoclonal antibody (M10), clone 2E9.
Lane 1: NFAM1 transfected lysate (Predicted MW: 29.7 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged NFAM1 is 10 ng/ml as a capture antibody.ELISA
-
Gene Info — NFAM1
Entrez GeneID
150372GeneBank Accession#
NM_145912Protein Accession#
NP_666017.1Gene Name
NFAM1
Gene Alias
CNAIP, FLJ40652, bK126B4.4
Gene Description
NFAT activating protein with ITAM motif 1
Omim ID
608740Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene is a type I membrane receptor that activates cytokine gene promoters such as the IL-13 and TNF-alpha promoters. The encoded protein contains an immunoreceptor tyrosine-based activation motif (ITAM) and is thought to regulate the signaling and development of B-cells. [provided by RefSeq
Other Designations
NFAT activation molecule 1|OTTHUMP00000028683|calcinerin/NFAT-activating ITAM-containing protein
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com