Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

  • By Application

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

DUSP18 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00150290-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human DUSP18 protein.
  • Immunogen:
  • DUSP18 (NP_689724.3, 1 a.a. ~ 188 a.a) full-length human protein.
  • Sequence:
  • MTAPSCAFPVQFRQPSVSGLSQITKSLYISNGVAANNKLMLSSNQITMVINVSVEVVNTLYEDIQYMQVPVADSPNSRLCDFFDPIADHIHSVEMKQGRTLLHCAAGVSRSAALCLAYLMKYHAMSLLDAHTWTKSCRPIIRPNSGFWEQLIHYEFQLFGKNTVHMVSSPVGMIPDIYEKEVRLMIPL
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of DUSP18 expression in transfected 293T cell line (H00150290-T01) by DUSP18 MaxPab polyclonal antibody.

    Lane 1: DUSP18 transfected lysate(20.68 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • DUSP18
  • Gene Alias:
  • DSP18,DUSP20,LMWDSP20,MGC32658,bK963H5.1
  • Gene Description:
  • dual specificity phosphatase 18
  • Gene Summary:
  • DUSP18 is a member of the dual-specificity phosphatase (DSP) family (see DUSP1; MIM 600714), which catalyzes dephosphorylation of phosphotyrosine and phosphothreonine residues (Hood et al., 2002 [PubMed 12408986]).[supplied by OMIM
  • Other Designations:
  • low molecular weight dual specificity phosphatase 20
  • RSS
  • YouTube
  • Linkedin
  • Facebook