WFDC5 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of WFDC5 expression in transfected 293T cell line (H00149708-T01) by WFDC5 MaxPab polyclonal antibody.
Lane 1: WFDC5 transfected lysate(13.53 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human WFDC5 protein.
Immunogen
WFDC5 (NP_663627.1, 1 a.a. ~ 123 a.a) full-length human protein.
Sequence
MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQCVPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of WFDC5 expression in transfected 293T cell line (H00149708-T01) by WFDC5 MaxPab polyclonal antibody.
Lane 1: WFDC5 transfected lysate(13.53 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — WFDC5
Entrez GeneID
149708GeneBank Accession#
NM_145652.2Protein Accession#
NP_663627.1Gene Name
WFDC5
Gene Alias
PRG5, WAP1, dJ211D12.5
Gene Description
WAP four-disulfide core domain 5
Omim ID
605161Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. [provided by RefSeq
Other Designations
OTTHUMP00000043834|p53-responsive gene 5|protease inhibitor WAP1
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com