Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

WFDC5 purified MaxPab mouse polyclonal antibody (B01P)MaxPab

  • Catalog # : H00149708-B01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human WFDC5 protein.
  • Immunogen:
  • WFDC5 (NP_663627.1, 1 a.a. ~ 123 a.a) full-length human protein.
  • Sequence:
  • MRTQSLLLLGALLAVGSQLPAVFGRKKGEKSGGCPPDDGPCLLSVPDQCVEDSQCPLTRKCCYRACFRQCVPRVSVKLGSCPEDQLRCLSPMNHLCHKDSDCSGKKRCCHSACGRDCRDPARG
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of WFDC5 expression in transfected 293T cell line (H00149708-T01) by WFDC5 MaxPab polyclonal antibody.

    Lane 1: WFDC5 transfected lysate(13.53 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • WFDC5
  • Gene Alias:
  • PRG5,WAP1,dJ211D12.5
  • Gene Description:
  • WAP four-disulfide core domain 5
  • Gene Summary:
  • This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. Most WFDC proteins contain only one WFDC domain, and this encoded protein contains two WFDC domains. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. Most WFDC gene members are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the centromeric cluster. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000043834,p53-responsive gene 5,protease inhibitor WAP1
  • RSS
  • YouTube
  • Linkedin
  • Facebook