Product Browser

Last updated: 2017/12/17

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CLDN19 (Human) Recombinant Protein (Q01)

  • Catalog # : H00149461-Q01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human CLDN19 partial ORF ( NP_683763.1, 29 a.a. - 81 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • QWKQSSYAGDAIITAVGPYEGLWMSCASQSTGQVQCKLYDSLLALDGHIQSAR
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 31.57
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00149461-Q01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • CLDN19
  • Gene Alias:
  • -
  • Gene Description:
  • claudin 19
  • Gene Summary:
  • The product of this gene belongs to the claudin family. It plays a major role in tight junction-specific obliteration of the intercellular space, through calcium-independent cell-adhesion activity. Defects in this gene are the cause of hypomagnesemia renal with ocular involvement (HOMGO). HOMGO is a progressive renal disease characterized by primary renal magnesium wasting with hypomagnesemia, hypercalciuria and nephrocalcinosis associated with severe ocular abnormalities such as bilateral chorioretinal scars, macular colobomata, significant myopia and nystagmus. Two transcript variants encoding distinct isoforms have been identified for this gene. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000008733
  • RSS
  • YouTube
  • Linkedin
  • Facebook