Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

MOBKL2C polyclonal antibody (A01)

  • Catalog # : H00148932-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant MOBKL2C.
  • Immunogen:
  • MOBKL2C (NP_958805, 121 a.a. ~ 216 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • LMDWIEGLINDEEVFPTRVGVPFPKNFQQVCTKILTRLFRVFVHVYIHHFDSILSMGAEAHVNTCYKHFYYFIREFSLVDQRELEPLREMTERICH
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00148932-A01
    Western Blot detection against Immunogen (36.67 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • MOBKL2C
  • Gene Alias:
  • MGC26743,MOB3C
  • Gene Description:
  • MOB1, Mps One Binder kinase activator-like 2C (yeast)
  • Gene Summary:
  • The protein encoded by this gene is similar to the yeast Mob1 protein. Yeast Mob1 binds Mps1p, a protein kinase essential for spindle pole body duplication and mitotic checkpoint regulation. Alternatively spliced transcript variants encoding distinct isoforms have been observed. [provided by RefSeq
  • Other Designations:
  • MOB1, Mps One Binder kinase activator-like 2C,OTTHUMP00000009682
  • RSS
  • YouTube
  • Linkedin
  • Facebook