HFE2 monoclonal antibody (M01), clone 1C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HFE2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HFE2 is 3 ng/ml as a capture antibody.
Western Blot detection against Immunogen (34.65 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant HFE2.
Immunogen
HFE2 (NP_973733, 93 a.a. ~ 173 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (34.65 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of monoclonal antibody to HFE2 on formalin-fixed paraffin-embedded human liver. [antibody concentration 3 ug/ml]Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged HFE2 is 3 ng/ml as a capture antibody.ELISA
-
Gene Info — HFE2
Entrez GeneID
148738GeneBank Accession#
NM_202004Protein Accession#
NP_973733Gene Name
HFE2
Gene Alias
HFE2A, HJV, JH, MGC23953, RGMC
Gene Description
hemochromatosis type 2 (juvenile)
Gene Ontology
HyperlinkGene Summary
The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq
Other Designations
OTTHUMP00000015582|OTTHUMP00000015583|OTTHUMP00000059680|RGM domain family, member C|hemochromatosis type 2 protein|hemojuvelin
-
Disease
-
Publication Reference
-
The functional role of hemojuvelin in acute ischemic stroke.
Young GH, Tang SC, Wu VC, Wang KC, Nong JY, Huang PY, Hu CJ, Chiou HY, Jeng JS, Hsu CY.
Journal of Cerebral Blood Flow and Metabolism 2020 Jun; 40(6):1316.
Application：IF, IHC-P, Human, Mouse, Brain tissues, Neurons.
-
The functional role of hemojuvelin in acute ischemic stroke.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com