HFE2 purified MaxPab rabbit polyclonal antibody (D01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Tissue lysate)
HFE2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HFE2 expression in mouse spleen.
Western Blot (Transfected lysate)
Western Blot analysis of HFE2 expression in transfected 293T cell line (H00148738-T01) by HFE2 MaxPab polyclonal antibody.
Lane 1: HFE2 transfected lysate(33.70 KDa).
Lane 2: Non-transfected lysate.
-
Specification
Product Description
Rabbit polyclonal antibody raised against a full-length human HFE2 protein.
Immunogen
HFE2 (NP_660320.3, 1 a.a. ~ 313 a.a) full-length human protein.
Sequence
MIQHNCSRQGPTAPPPPRGPALPGAGSGLPAPDPCDYEGRFSRLHGRPPGFLHCASFGDPHVRSFHHHFHTCRVQGAWPLLDNDFLFVQATSSPMALGANATATRKLTIIFKNMQECIDQKVYQAEVDNLPVAFEDGSINGGDRPGGSSLSIQTANPGNHVEIQAAYIGTTIIIRQTAGQLSFSIKVAEDVAMAFSAEQDLQLCVGGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPSDAGVPLSSATLLAPLLSGLFVLWLCIQ
Host
Rabbit
Reactivity
Human, Mouse
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Tissue lysate)
HFE2 MaxPab rabbit polyclonal antibody. Western Blot analysis of HFE2 expression in mouse spleen.Western Blot (Transfected lysate)
Western Blot analysis of HFE2 expression in transfected 293T cell line (H00148738-T01) by HFE2 MaxPab polyclonal antibody.
Lane 1: HFE2 transfected lysate(33.70 KDa).
Lane 2: Non-transfected lysate.
-
Gene Info — HFE2
Entrez GeneID
148738GeneBank Accession#
NM_145277.3Protein Accession#
NP_660320.3Gene Name
HFE2
Gene Alias
HFE2A, HJV, JH, MGC23953, RGMC
Gene Description
hemochromatosis type 2 (juvenile)
Gene Ontology
HyperlinkGene Summary
The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq
Other Designations
OTTHUMP00000015582|OTTHUMP00000015583|OTTHUMP00000059680|RGM domain family, member C|hemochromatosis type 2 protein|hemojuvelin
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com