Product Browser

Last updated: 2017/7/23

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

HFE2 polyclonal antibody (A01)

  • Catalog # : H00148738-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant HFE2.
  • Immunogen:
  • HFE2 (NP_973733, 93 a.a. ~ 173 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • GGCPPSQRLSRSERNRRGAITIDTARRLCKEGLPVEDAYFHSCVFDVLISGDPNFTVAAQAALEDARAFLPDLEKLHLFPS
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00148738-A01
    Western Blot detection against Immunogen (35.02 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Publication Reference
  • Applications
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • HFE2 polyclonal antibody (A01), Lot # 060519JCS1 Western Blot analysis of HFE2 expression in U-2 OS ( Cat # L022V1 ).
  • PDF DownloadProtocol Download
  • ELISA
  • Application Image
  • Western Blot (Cell lysate)
  • Western Blot (Cell lysate)
  • enlarge
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • HFE2
  • Gene Alias:
  • HFE2A,HJV,JH,MGC23953,RGMC
  • Gene Description:
  • hemochromatosis type 2 (juvenile)
  • Gene Summary:
  • The product of this gene is involved in iron metabolism. It may be a component of the signaling pathway which activates hepcidin or it may act as a modulator of hepcidin expression. It could also represent the cellular receptor for hepcidin. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. Defects in this gene are the cause of hemochromatosis type 2A, also called juvenile hemochromatosis (JH). JH is an early-onset autosomal recessive disorder due to severe iron overload resulting in hypogonadotrophic hypogonadism, hepatic fibrosis or cirrhosis and cardiomyopathy, occurring typically before age of 30. [provided by RefSeq
  • Other Designations:
  • OTTHUMP00000015582,OTTHUMP00000015583,OTTHUMP00000059680,RGM domain family, member C,hemochromatosis type 2 protein,hemojuvelin
  • RSS
  • YouTube
  • Linkedin
  • Facebook