CREB3L4 monoclonal antibody (M01), clone 3E3
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of CREB3L4 expression in transfected 293T cell line by CREB3L4 monoclonal antibody (M01), clone 3E3.
Lane 1: CREB3L4 transfected lysate(43.4 KDa).
Lane 2: Non-transfected lysate.
RNAi Knockdown (Antibody validated)
Western blot analysis of CREB3L4 over-expressed 293 cell line, cotransfected with CREB3L4 Validated Chimera RNAi ( Cat # H00148327-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CREB3L4 monoclonal antibody (M01), clone 3E3 (Cat # H00148327-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.
In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CREB3 and CREB3L4. HeLa cells were stained with anti-CREB3 rabbit purified polyclonal 1:1200 and anti-CREB3L4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).
Immunofluorescence
Immunofluorescence of monoclonal antibody to CREB3L4 on HeLa cell . [antibody concentration 10 ug/ml]
Western Blot detection against Immunogen (37.84 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CREB3L4.
Immunogen
CREB3L4 (NP_570968, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDLGIPDLLDAWLEPPEDIFSTGSVLELGLHCPPPEVPVTRLQEQGLQGWKSGGDRGCGLQESEPEDFLKLFIDPNEVYCSEASPGSDSGISEDPCHPDSPPAPRATSSP
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (37.84 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of CREB3L4 expression in transfected 293T cell line by CREB3L4 monoclonal antibody (M01), clone 3E3.
Lane 1: CREB3L4 transfected lysate(43.4 KDa).
Lane 2: Non-transfected lysate.
Western Blot (Recombinant protein)
ELISA
RNAi Knockdown (Antibody validated)
Western blot analysis of CREB3L4 over-expressed 293 cell line, cotransfected with CREB3L4 Validated Chimera RNAi ( Cat # H00148327-R01V ) (Lane 2) or non-transfected control (Lane 1). Blot probed with CREB3L4 monoclonal antibody (M01), clone 3E3 (Cat # H00148327-M01 ). GAPDH ( 36.1 kDa ) used as specificity and loading control.In situ Proximity Ligation Assay (Cell)
Proximity Ligation Analysis of protein-protein interactions between CREB3 and CREB3L4. HeLa cells were stained with anti-CREB3 rabbit purified polyclonal 1:1200 and anti-CREB3L4 mouse monoclonal antibody 1:50. Each red dot represents the detection of protein-protein interaction complex, and nuclei were counterstained with DAPI (blue).Immunofluorescence
Immunofluorescence of monoclonal antibody to CREB3L4 on HeLa cell . [antibody concentration 10 ug/ml] -
Gene Info — CREB3L4
Entrez GeneID
148327GeneBank Accession#
NM_130898Protein Accession#
NP_570968Gene Name
CREB3L4
Gene Alias
AIBZIP, ATCE1, CREB3, CREB4, JAL, hJAL
Gene Description
cAMP responsive element binding protein 3-like 4
Omim ID
607138Gene Ontology
HyperlinkGene Summary
cAMP response element-binding (CREB) proteins are a family of mammalian transcription activators. For further background information on CREB proteins, see CREB1 (MIM 123810).[supplied by OMIM
Other Designations
OTTHUMP00000035264|OTTHUMP00000035265|OTTHUMP00000035266|androgen-induced basic leucine zipper|cAMP responsive element binding protein 1
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com