Product Browser

Last updated: 2016/12/4
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

CKLFSF4 polyclonal antibody (A01)

  • Catalog # : H00146223-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant CKLFSF4.
  • Immunogen:
  • CKLFSF4 (NP_848933, 173 a.a. ~ 234 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • QKWRVSVRQQSTNDYIRARTESRDVDSRPEIQRLDTFSYSTNVTVRKKSPTNLLSLNHWQLA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00146223-A01
    Western Blot detection against Immunogen (32.93 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • CMTM4
  • Gene Alias:
  • CKLFSF4
  • Gene Description:
  • CKLF-like MARVEL transmembrane domain containing 4
  • Gene Summary:
  • This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and the transmembrane 4 superfamilies of signaling molecules. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq
  • Other Designations:
  • chemokine-like factor super family 4,chemokine-like factor superfamily 4
  • RSS
  • YouTube
  • Linkedin
  • Facebook