CDAN1 monoclonal antibody (M01), clone 7A10
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse monoclonal antibody raised against a partial recombinant CDAN1.
Immunogen
CDAN1 (NP_612486.2, 1130 a.a. ~ 1227 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
PLQLLLSPRNVGLLADTRPREWDLLLFLLRELVEKGLMGRMEIEACLGSLHQAQWPGDFAEELATLSNLFLAEPHLPEPQLRACELVQPNRGTVLAQS
Host
Mouse
Reactivity
Human
Isotype
IgG2a Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (36.52 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Cell lysate)
CDAN1 monoclonal antibody (M01), clone 7A10. Western Blot analysis of CDAN1 expression in K-562.Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged CDAN1 is 1 ng/ml as a capture antibody.ELISA
-
Gene Info — CDAN1
Entrez GeneID
146059GeneBank Accession#
NM_138477Protein Accession#
NP_612486.2Gene Name
CDAN1
Gene Alias
CDA-I, CDA1, CDAI, DLT, PRO1295, codanin
Gene Description
congenital dyserythropoietic anemia, type I
Gene Ontology
HyperlinkGene Summary
This gene encodes a protein that appears to play a role in nuclear envelope integrity, possibly related to microtubule attachments. Mutations in this gene cause congenital dyserythropoietic anemia type I, a disease resulting in morphological and functional abnormalities of erythropoiesis. [provided by RefSeq
Other Designations
codanin 1
-
Interactome
-
Publication Reference
-
A complex comprising C15ORF41 and Codanin-1- the products of two genes mutated in congenital dyserythropoietic anemia type I (CDA-I).
Shroff M, Knebel A, Toth R, Rouse J.
The Biochemical Journal 2020 May; 477(10):1893.
Application:IP, WB, Human, HEK 293 cell.
-
A complex comprising C15ORF41 and Codanin-1- the products of two genes mutated in congenital dyserythropoietic anemia type I (CDA-I).
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com