Product Browser

Last updated: 2017/8/20
  • Related Product Showcase
  • By Pathway

  • By Antibody/Protein

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

NRG4 purified MaxPab rabbit polyclonal antibody (D01P)MaxPab

  • Catalog # : H00145957-D01P
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Rabbit polyclonal antibody raised against a full-length human NRG4 protein.
  • Immunogen:
  • NRG4 (NP_612640.1, 1 a.a. ~ 115 a.a) full-length human protein.
  • Sequence:
  • MPTDHEEPCGPSHKSFCLNGGLCYVIPTIPSPFCRCVENYTGARCEEVFLPGSSIQTKSNLFEAFVALAVLVTLIIGAFYFLCRKGHFQRASSVQYDINLVETSSTSAHHSHEQH
  • Host:
  • Rabbit
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • In 1x PBS, pH 7.4
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of NRG4 expression in transfected 293T cell line (H00145957-T02) by NRG4 MaxPab polyclonal antibody.

    Lane 1: NRG4 transfected lysate(12.70 KDa).
    Lane 2: Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • NRG4
  • Gene Alias:
  • DKFZp779N0541,DKFZp779N1944,HRG4
  • Gene Description:
  • neuregulin 4
  • Gene Summary:
  • The neuregulins, including NRG4, activate type-1 growth factor receptors (see EGFR; MIM 131550) to initiating cell-to-cell signaling through tyrosine phosphorylation (Harari et al., 1999 [PubMed 10348342]).[supplied by OMIM
  • Other Designations:
  • OTTHUMP00000183575,heregulin 4
  • Gene Pathway
  • RSS
  • YouTube
  • Linkedin
  • Facebook