Product Browser

Last updated: 2016/12/4

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

A2ML1 (Human) Recombinant Protein (P01)

  • Catalog # : H00144568-P01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Human A2ML1 full-length ORF ( AAH93840.1, 1 a.a. - 158 a.a.) recombinant protein with GST-tag at N-terminal.
  • Sequence:
  • MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE
  • Host:
  • Wheat Germ (in vitro)
  • Theoretical MW (kDa):
  • 44.1
  • Purification:
  • Glutathione Sepharose 4 Fast Flow
  • Quality Control Testing:
  • 12.5% SDS-PAGE Stained with Coomassie Blue.

    QC Testing of H00144568-P01
  • Storage Buffer:
  • 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
  • Storage Instruction:
  • Store at -80°C. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • Best use within three months from the date of receipt of this protein.
  • Applications
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Application Image
  • Enzyme-linked Immunoabsorbent Assay
  • Western Blot (Recombinant protein)
  • Antibody Production
  • Protein Array
  • Gene Information
  • Gene Name:
  • A2ML1
  • Gene Alias:
  • CPAMD9,DKFZp686C1729,DKFZp686D2011,DKFZp686G1812,DKFZp686L1821,DKFZp686O1010,FLJ16045,FLJ25179,FLJ39129,FLJ41597,FLJ41598,FLJ41607
  • Gene Description:
  • alpha-2-macroglobulin-like 1
  • Gene Summary:
  • The alpha-macroglobulin (AM) superfamily of proteins contains both complement components and protease inhibitors, including A2M (MIM 103950) and A2ML1. AM proteins display a unique trap mechanism of inhibition, by which the AM inhibitor undergoes a major conformational change upon its cleavage by a protease, thus trapping the protease and blocking it from subsequent substrate binding (Galliano et al., 2006 [PubMed 16298998]).[supplied by OMIM
  • Other Designations:
  • C3 and PZP-like, alpha-2-macroglobulin domain containing 9,OTTHUMP00000158614
  • RSS
  • YouTube
  • Linkedin
  • Facebook