A2ML1 purified MaxPab mouse polyclonal antibody (B01P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Mouse polyclonal antibody raised against a full-length human A2ML1 protein.
Immunogen
A2ML1 (AAH93840.1, 1 a.a. ~ 158 a.a) full-length human protein.
Sequence
MYTLEASGQGCVYVQTVLRYNILPPTNMKTFSLSVEIGKARCEQPTSPRSLTLTIHTSYVGSRSSSNMAIVEVKMLSGFSPMEGTNQLLLQQPLVKKVEFGTDTLNIYLDELIKNTQTYTFTISQSVLVTNLKPATIKVYDYYLPDEQATIQYSDPCE
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of A2ML1 expression in transfected 293T cell line (H00144568-T01) by A2ML1 MaxPab polyclonal antibody.
Lane1:A2ML1 transfected lysate(17.38 KDa).
Lane2:Non-transfected lysate.
-
Gene Info — A2ML1
Entrez GeneID
144568GeneBank Accession#
BC093840.1Protein Accession#
AAH93840.1Gene Name
A2ML1
Gene Alias
CPAMD9, DKFZp686C1729, DKFZp686D2011, DKFZp686G1812, DKFZp686L1821, DKFZp686O1010, FLJ16045, FLJ25179, FLJ39129, FLJ41597, FLJ41598, FLJ41607
Gene Description
alpha-2-macroglobulin-like 1
Omim ID
610627Gene Ontology
HyperlinkGene Summary
The alpha-macroglobulin (AM) superfamily of proteins contains both complement components and protease inhibitors, including A2M (MIM 103950) and A2ML1. AM proteins display a unique trap mechanism of inhibition, by which the AM inhibitor undergoes a major conformational change upon its cleavage by a protease, thus trapping the protease and blocking it from subsequent substrate binding (Galliano et al., 2006 [PubMed 16298998]).[supplied by OMIM
Other Designations
C3 and PZP-like, alpha-2-macroglobulin domain containing 9|OTTHUMP00000158614
-
Interactome
-
Disease
-
Publication Reference
-
Laboratory diagnosis of paraneoplastic pemphigus.
Poot AM, Diercks GF, Kramer D, Schepens I, Klunder G, Hashimoto T, Borradori L, Jonkman MF, Pas HH.
The British Journal of Dermatology 2013 Nov; 169(5):1016.
Application:ELISA, IF, WB-Ce, Human, Rat, Bladders, Keratinocytes, Serum.
-
The protease inhibitor alpha-2-macroglobulin-like-1 is the p170 antigen recognized by paraneoplastic pemphigus autoantibodies in human.
Schepens I, Jaunin F, Begre N, Laderach U, Marcus K, Hashimoto T, Favre B, Borradori L.
PLoS One 2010 Aug; 5(8):e12250.
Application:IF, IHC, WB-Ce, WB-Tr, Human, HEK 293T cells, Human breast skin, Human keratinocytes.
-
Laboratory diagnosis of paraneoplastic pemphigus.
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com