OR51E1 (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human OR51E1 partial ORF (NP_689643.1, 201 a.a. - 300 a.a.) recombinant protein with GST tag at N-terminal.
Sequence
GLIVIISAIGLDSLLISFSYLLILKTVLGLTREAQAKAFGTCVSHVCAVFIFYVPFIGLSMVHRFSKRRDSPLPVILANIYLLVPPVLNPIVYGVKTKEI
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.63
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — OR51E1
Entrez GeneID
143503GeneBank Accession#
NM_152430.2Protein Accession#
NP_689643.1Gene Name
OR51E1
Gene Alias
D-GPCR, FLJ13581, GPR136, GPR164, MGC24137, OR51E1P, OR52A3P, POGR, PSGR2
Gene Description
olfactory receptor, family 51, subfamily E, member 1
Omim ID
611267Gene Ontology
HyperlinkGene Summary
Olfactory receptors interact with odorant molecules in the nose, to initiate a neuronal response that triggers the perception of a smell. The olfactory receptor proteins are members of a large family of G-protein-coupled receptors (GPCR) arising from single coding-exon genes. Olfactory receptors share a 7-transmembrane domain structure with many neurotransmitter and hormone receptors and are responsible for the recognition and G protein-mediated transduction of odorant signals. The olfactory receptor gene family is the largest in the genome. The nomenclature assigned to the olfactory receptor genes and proteins for this organism is independent of other organisms. [provided by RefSeq
Other Designations
Dresden-G-protein-coupled receptor|olfactory receptor OR11-15|olfactory receptor, family 51, subfamily E, member 1 pseudogene|olfactory receptor, family 52, subfamily A, member 3 pseudogene|prostate overexpressed G protein-coupled receptor
-
Pathway
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com