Product Browser

Last updated: 2016/12/4
  • Related Product Showcase

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

C20orf79 MaxPab mouse polyclonal antibody (B01)MaxPab

  • Catalog # : H00140856-B01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a full-length human C20orf79 protein.
  • Immunogen:
  • C20orf79 (NP_848578.1, 1 a.a. ~ 156 a.a) full-length human protein.
  • Sequence:
  • MWKRSDHQPKIKAEDGPLVGQFEVLGSVPEPAMPHPLELSEFESFPVFQDIRLHIREVGAQLVKKVNAVFQLDITKNGKTILRWTIDLKNGSGDMYPGPARLPADTVFTIPESVFMELVLGKMNPQKAFLAGKFKVSGKVLLSWKLERVFKDWAKF
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody reactive against mammalian transfected lysate.
  • Storage Buffer:
  • No additive
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Note:
  • For IHC and IF applications, antibody purification with Protein A will be needed prior to use.
  • Applications
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • Western Blot analysis of C20orf79 expression in transfected 293T cell line (H00140856-T01) by C20orf79 MaxPab polyclonal antibody.

    Lane1:C20orf79 transfected lysate(17.16 KDa).
    Lane2:Non-transfected lysate.
  • PDF DownloadProtocol Download
  • Application Image
  • Western Blot (Transfected lysate)
  • Western Blot (Transfected lysate)
  • enlarge
  • Gene Information
  • Gene Name:
  • C20orf79
  • Gene Alias:
  • HSD22,MGC138229,dJ1068E13.2
  • Gene Description:
  • chromosome 20 open reading frame 79
  • Other Designations:
  • OTTHUMP00000030367,hypothetical protein LOC140856,sterol carrier protein 2-like protein
  • RSS
  • YouTube
  • Linkedin
  • Facebook