CTCFL (Human) Recombinant Protein (Q01)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
-
Specification
Product Description
Human CTCFL partial ORF ( NP_542185, 193 a.a. - 293 a.a.) recombinant protein with GST-tag at N-terminal.
Sequence
AERTKEQLFFVETMSGDERSDEIVLTVSNSNVEEQEDQPTAGQADAEKAKSTKNQRKTKGAKGTFHCDVCMFTSSRMSSFNRHMKTHTSEKPHLCHLCLKT
Host
Wheat Germ (in vitro)
Theoretical MW (kDa)
36.85
Preparation Method
Purification
Glutathione Sepharose 4 Fast Flow
Quality Control Testing
12.5% SDS-PAGE Stained with Coomassie Blue.
Storage Buffer
50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Storage Instruction
Store at -80°C. Aliquot to avoid repeated freezing and thawing.
Note
Best use within three months from the date of receipt of this protein.
-
Applications
Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
-
Gene Info — CTCFL
Entrez GeneID
140690GeneBank Accession#
NM_080618Protein Accession#
NP_542185Gene Name
CTCFL
Gene Alias
BORIS, CTCF-T, MGC163358, dJ579F20.2
Gene Description
CCCTC-binding factor (zinc finger protein)-like
Omim ID
607022Gene Ontology
HyperlinkGene Summary
CCCTC-binding factor (CTCF), an 11-zinc-finger factor involved in gene regulation, utilizes different zinc fingers to bind varying DNA target sites. CTCF forms methylation-sensitive insulators that regulate X-chromosome inactivation. This gene is a paralog of CTCF and appears to be expressed primarily in the cytoplasm of spermatocytes, unlike CTCF which is expressed primarily in the nucleus of somatic cells. CTCF and the protein encoded by this gene are normally expressed in a mutually exclusive pattern that correlates with resetting of methylation marks during male germ cell differentiation. [provided by RefSeq
Other Designations
BORIS-like protein|CCCTC-binding factor-like protein|OTTHUMP00000174287|brother of the regulator of imprinted sites
-
Interactome
-
Disease
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com