WFDC3 monoclonal antibody (M03), clone 5C12
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WFDC3 is 0.1 ng/ml as a capture antibody.
Western Blot detection against Immunogen (31.7 KDa) .
-
Specification
Product Description
Mouse monoclonal antibody raised against a full-length recombinant WFDC3.
Immunogen
WFDC3 (AAH26014.2, 1 a.a. ~ 48 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Sequence
MDENCQAGEKCCKSGCGRFCVPPVLPPKLTMNPNWTVRSDSELEIPVP
Host
Mouse
Reactivity
Human
Isotype
IgG1 Kappa
Quality Control Testing
Antibody Reactive Against Recombinant Protein.
Western Blot detection against Immunogen (31.7 KDa) .
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Recombinant protein)
Sandwich ELISA (Recombinant protein)
Detection limit for recombinant GST tagged WFDC3 is 0.1 ng/ml as a capture antibody.ELISA
-
Gene Info — WFDC3
Entrez GeneID
140686GeneBank Accession#
BC026014.1Protein Accession#
AAH26014.2Gene Name
WFDC3
Gene Alias
WAP14, dJ447F3.3
Gene Description
WAP four-disulfide core domain 3
Gene Ontology
HyperlinkGene Summary
This gene encodes a member of the WAP-type four-disulfide core (WFDC) domain family. The WFDC domain, or WAP signature motif, contains eight cysteines forming four disulfide bonds at the core of the protein, and functions as a protease inhibitor. The encoded protein contains four WFDC domains. Most WFDC genes are localized to chromosome 20q12-q13 in two clusters: centromeric and telomeric. This gene belongs to the telomeric cluster. Alternatively spliced transcript variants have been observed but their full-length nature has not been determined. [provided by RefSeq
Other Designations
OTTHUMP00000196627|protease inhibitor WAP14|whey acidic protein 14
-
Interactome
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com