Product Browser

Last updated: 2016/11/27
  • Related Product Showcase
  • By Research Area

Product Compare

Product Compare Cancel Click this icon to add products to compare list. Select up to 10 products.

Quick Order (Tutorial)

Input Catalog #,
place order here!
Catalog # :
  • Where to buy
  • Choose your location

GATA5 polyclonal antibody (A01)

  • Catalog # : H00140628-A01
  • Visit Frequency :
  • Countries :
  • Specification
  • Product Description:
  • Mouse polyclonal antibody raised against a partial recombinant GATA5.
  • Immunogen:
  • GATA5 (NP_536721, 336 a.a. ~ 397 a.a) partial recombinant protein with GST tag.
  • Sequence:
  • PVCPGPSMAPQASGQEDDSLAPGHLEFKFEPEDFAFPSTAPSPQAGLRGALRQEAWCALALA
  • Host:
  • Mouse
  • Reactivity:
  • Human
  • Quality Control Testing:
  • Antibody Reactive Against Recombinant Protein.

    QC Testing of H00140628-A01
    Western Blot detection against Immunogen (32.93 KDa) .
  • Storage Buffer:
  • 50 % glycerol
  • Storage Instruction:
  • Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
  • Applications
  • ELISA
  • Application Image
  • Western Blot (Recombinant protein)
  • ELISA
  • Gene Information
  • Gene Name:
  • GATA5
  • Gene Alias:
  • bB379O24.1
  • Gene Description:
  • GATA binding protein 5
  • Gene Summary:
  • The protein encoded by this gene is a transcription factor that contains two GATA-type zinc fingers. The encoded protein is known to bind to hepatocyte nuclear factor-1alpha (HNF-1alpha), and this interaction is essential for cooperative activation of the intestinal lactase-phlorizin hydrolase promoter. In other organisms, similar proteins may be involved in the establishment of cardiac smooth muscle cell diversity. [provided by RefSeq
  • Other Designations:
  • GATA binding factor-5,GATA-binding protein 5,OTTHUMP00000031490,transcription factor GATA-5
  • RSS
  • YouTube
  • Linkedin
  • Facebook