RNF32 purified MaxPab mouse polyclonal antibody (B02P)
* The price is valid only in USA. Please select country.
-
More Files
- More Functions
Western Blot (Transfected lysate)
Western Blot analysis of RNF32 expression in transfected 293T cell line (H00140545-T02) by RNF32 MaxPab polyclonal antibody.
Lane 1: RNF32 transfected lysate(28.16 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to RNF32 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml]
-
Specifications
Product Description
Mouse polyclonal antibody raised against a full-length human RNF32 protein.
Immunogen
RNF32 (AAH28120.1, 1 a.a. ~ 256 a.a) full-length human protein.
Sequence
MLKNKGHSSKKDNLAVNAVALQDHILHDLQLRNLSVADHSKTQVQKKENKSLKRDTKAIIDTGLKKTTQCPKLEDSEKEYVLDPKPPPLTLAQKLGLIGPPPPPLSSDEWEKVKQRSLLQGDSVQPCPICKEEFELRPQVLLSCSHVFHKACLQAFEKFTNKKTCPLCRKNQYQTRVIHDGARLFRIKCVTRIQAYWRGCVVRKWYRNLRKTVPPTDAKLRKNSLKKSSQKSATASCAHTTPTLKSSLQKSISAWP
Host
Mouse
Reactivity
Human
Quality Control Testing
Antibody reactive against mammalian transfected lysate.
Storage Buffer
In 1x PBS, pH 7.4
Storage Instruction
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
Applications
Western Blot (Transfected lysate)
Western Blot analysis of RNF32 expression in transfected 293T cell line (H00140545-T02) by RNF32 MaxPab polyclonal antibody.
Lane 1: RNF32 transfected lysate(28.16 KDa).
Lane 2: Non-transfected lysate.
Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
Immunoperoxidase of purified MaxPab antibody to RNF32 on formalin-fixed paraffin-embedded human esophagus. [antibody concentration 3 ug/ml] -
Gene Info — RNF32
Entrez GeneID
140545GeneBank Accession#
BC028120.1Protein Accession#
AAH28120.1Gene Name
RNF32
Gene Alias
FKSG33, HSD15
Gene Description
ring finger protein 32
Omim ID
610241Gene Ontology
HyperlinkGene Summary
The protein encoded by this gene contains two RING ring finger motifs. RING finger motifs are present in a variety of functionally distinct proteins and are known to be involved in protein-DNA or protein-protein interactions. This gene was found to be expressed during spermatogenesis, most likely in spermatocytes and/or in spermatids. Several alternatively spliced transcript variants exist, but their full length natures are not clear. [provided by RefSeq
Other Designations
-
-
Interactomes
- +1-909-264-1399
+1-909-992-0619
Toll Free : +1-877-853-6098 - +1-909-992-3401
- sales@abnova.com